General Information of Protein (ID: PRT00078) |
Name |
Fibrinogen (FGG)
|
Synonyms |
Click to Show/Hide Synonyms of This Protein
PRO2061; FGG
|
Gene Name |
FGG
|
Gene ID |
|
UniProt ID |
|
Family |
Fibrinogen (FibGe)
|
|
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
|
Sequence |
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIM KYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI GEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL
|
Structure |
1DUG
; 1FIB
; 1FIC
; 1FID
; 1FZA
; 1FZB
; 1FZC
; 1FZE
; 1FZF
; 1FZG
; 1LT9
; 1LTJ
; 1N86
; 1N8E
; 1RE3
; 1RE4
; 1RF0
; 1RF1
; 2A45
; 2FFD
; 2FIB
; 2H43
; 2HLO
; 2HOD
; 2HPC
; 2HWL
; 2OYH
; 2OYI
; 2Q9I
; 2VDO
; 2VDP
; 2VDQ
; 2VDR
; 2VR3
; 2XNX
; 2XNY
; 2Y7L
; 2Z4E
; 3BVH
; 3E1I
; 3FIB
; 3GHG
; 3H32
; 3HUS
; 4B60
|
Function |
Together with fibrinogen alpha (FGA) and fibrinogen beta (FGB), polymerizes to form an insoluble fibrin matrix. Has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However, subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets via an ITGB3-dependent pathway. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways.
|
Regulatory Network
|
|
|
|
|
|
|
|