Details of Protein

General Information of Protein (ID: PRT00078)
Name Fibrinogen (FGG)
Synonyms   Click to Show/Hide Synonyms of This Protein
PRO2061; FGG
Gene Name FGG Gene ID
2266
UniProt ID
P02679
Family Fibrinogen (FibGe)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT
KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIM
KYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY
RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
GEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL
Structure
1DUG ; 1FIB ; 1FIC ; 1FID ; 1FZA ; 1FZB ; 1FZC ; 1FZE ; 1FZF ; 1FZG ; 1LT9 ; 1LTJ ; 1N86 ; 1N8E ; 1RE3 ; 1RE4 ; 1RF0 ; 1RF1 ; 2A45 ; 2FFD ; 2FIB ; 2H43 ; 2HLO ; 2HOD ; 2HPC ; 2HWL ; 2OYH ; 2OYI ; 2Q9I ; 2VDO ; 2VDP ; 2VDQ ; 2VDR ; 2VR3 ; 2XNX ; 2XNY ; 2Y7L ; 2Z4E ; 3BVH ; 3E1I ; 3FIB ; 3GHG ; 3H32 ; 3HUS ; 4B60
Function Together with fibrinogen alpha (FGA) and fibrinogen beta (FGB), polymerizes to form an insoluble fibrin matrix. Has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However, subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets via an ITGB3-dependent pathway. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (576 hours)
                      Induced Change FGG protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that glutamine addition causes the decrease of FGG protein expression compared with control group.
References
1 Glutamine regulates the expression of proteins with a potential health-promoting effect in human intestinal Caco-2 cells. Proteomics. 2006 Apr;6(8):2454-64.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.