Details of Protein

General Information of Protein (ID: PRT00071)
Name Monocyte chemotactic and activating factor (CCL2)
Synonyms   Click to Show/Hide Synonyms of This Protein
HC11; Monocyte chemoattractant protein 1; Monocyte chemotactic and activating factor; MCAF; Monocyte chemotactic protein 1; MCP-1; Monocyte secretory protein JE; Small-inducible cytokine A2; CCL2; MCP1; SCYA2
Gene Name CCL2 Gene ID
6347
UniProt ID
P13500
Family Chemokine (CK)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
Structure
1DOK ; 1DOL ; 1DOM ; 1DON ; 1MCA ; 1ML0 ; 2BDN ; 2NZ1 ; 3IFD ; 4DN4 ; 4R8I ; 4ZK9
Function Acts as a ligand for C-C chemokine receptor CCR2. Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions. Exhibits a chemotactic activity for monocytes and basophils but not neutrophils or eosinophils. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Gamma-Glutamylvaline Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Gamma-Glutamylvaline addition (2 hours)
                      Induced Change CCL2 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Peritonitis [ICD-11: DC50]
                      Details It is reported that gamma-glutamylvaline addition causes the decrease of CCL2 protein expression compared with control group.
References
1 Dietary -Glutamyl Valine Ameliorates TNF--Induced Vascular Inflammation via Endothelial Calcium-Sensing Receptors. J Agric Food Chem. 2020 Aug 26;68(34):9139-9149.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.