Details of Protein

General Information of Protein (ID: PRT00064)
Name Apolipoprotein A-I (APOA1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Apo-AI; ApoA-I; Apolipoprotein A1; APOA1
Gene Name APOA1 Gene ID
335
UniProt ID
P02647
Family Apolipoprotein (Apo)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS
ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV
DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ
Structure
1AV1 ; 1GW3 ; 1GW4 ; 1ODP ; 1ODQ ; 1ODR ; 2MSC ; 2MSD ; 2MSE ; 2N5E ; 3K2S ; 3R2P ; 4V6M ; 6CC9 ; 6CCH ; 6CCX ; 6CLZ ; 6CM1 ; 6PTS ; 6PTW ; 6W4E ; 6W4F ; 7KJR
Function Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (576 hours)
                      Induced Change APOA1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that glutamine addition causes the decrease of APOA1 protein expression compared with control group.
            Oxoglutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Oxoglutaric acid addition (336 hours)
                      Induced Change APOA1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Parkinsonism [ICD-11: 8A00]
                      Details It is reported that oxoglutaric acid addition causes the decrease of APOA1 protein expression compared with control group.
References
1 Glutamine regulates the expression of proteins with a potential health-promoting effect in human intestinal Caco-2 cells. Proteomics. 2006 Apr;6(8):2454-64.
2 Dietary keto-acid feed-back on pituitary activity in gilthead sea bream: effects of oral doses of AKG. A proteomic approach. Gen Comp Endocrinol. 2010 Dec 1;169(3):284-92.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.