Details of Protein
| General Information of Protein (ID: PRT00061) | |||||
|---|---|---|---|---|---|
| Name | Progastricsin pepsinogen C (PGC) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Pepsinogen C; PGC
|
||||
| Gene Name | PGC | Gene ID | |||
| UniProt ID | |||||
| Family | Hydrolases (EC 3) | ||||
| EC Number | EC: 3.4.23.3 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLS
VTYEPMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSES STYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIM GLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQIY WAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTSLLTVPQQYMSALLQATGAQE DEYGQFLVNCNSIQNLPSLTFIINGVEFPLPPSSYILSNNGYCTVGVEPTYLSSQNGQPL WILGDVFLRSYYSVYDLGNNRVGFATAA |
||||
| Structure | |||||
| Function | Hydrolyzes a variety of proteins. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Leucine addition (5 hours) | |||||
| Induced Change | PGC protein expression levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that leucine addition causes the increase of PGC protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | An enteral leucine supply modulates human duodenal mucosal proteome and decreases the expression of enzymes involved in fatty acid beta-oxidation. J Proteomics. 2013 Jan 14;78:535-44. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.