Details of Protein
| General Information of Protein (ID: PRT00053) | |||||
|---|---|---|---|---|---|
| Name | Nuclear-interacting partner of ALK (ZC3HC1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Nuclear-interacting partner of anaplastic lymphoma kinase; hNIPA; Zinc finger C3HC-type protein 1; HSPC216; ZC3HC1; NIPA
|
||||
| Gene Name | ZC3HC1 | Gene ID | |||
| UniProt ID | |||||
| Family | Zinc finger protein (ZIN) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAAPCEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVN
GSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWVTVECDMLKCSSC QAFLCASLQPAFDFDRYKQRCAELKKALCTAHEKFCFWPDSPSPDRFGMLPLDEPAILVS EFLDRFQSLCHLDLQLPSLRPEDLKTMCLTEDKISLLLHLLEDELDHRTDERKTTIKLGS DIQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVGLWGFQQIESSMTDLDASFGL TSSPIPGLEGRPERLPLVPESPRRMMTRSQDATFSPGSEQAEKSPGPIVSRTRSWDSSSP VDRPEPEAASPTTRTRPVTRSMGTGDTPGLEVPSSPLRKAKRARLCSSSSSDTSSRSFFD PTSQHRDWCPWVNITLGKESRENGGTEPDASAPAEPGWKAVLTILLAHKQSSQPAETDSM SLSEKSRKVFRIFRQWESLCSC |
||||
| Function | Essential component of a SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry. May have an antiapoptotic role in NPM-ALK-mediated signaling events. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine absence (16 hours) | |||||
| Induced Change | ZC3HC1 protein abundance levels: decrease (FC = 0.75) | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
| Details | It is reported that glutamine absence causes the decrease of ZC3HC1 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.