Details of Protein

General Information of Protein (ID: PRT00050)
Name Ubiquitin-like protein Nedd8 (NEDD8)
Synonyms   Click to Show/Hide Synonyms of This Protein
Neddylin; Neural precursor cell expressed developmentally down-regulated protein 8; NEDD-8; Ubiquitin-like protein Nedd8; NEDD8
Gene Name NEDD8 Gene ID
4738
UniProt ID
Q15843
Family Ubiquitin/ubiquinone (UbiQ)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
ILGGSVLHLVLALRGGGGLRQ
Structure
1NDD ; 1R4M ; 1R4N ; 1XT9 ; 2BKR ; 2KO3 ; 2N7K ; 2NVU ; 3DBH ; 3DBL ; 3DBR ; 3DQV ; 3GZN ; 4F8C ; 4FBJ ; 4HCP ; 4P5O ; 6R7F ; 6R7I ; 6TTU
Function Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change NEDD8 protein abundance levels: increase (FC = 1.37)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of NEDD8 protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.