Details of Protein

General Information of Protein (ID: PRT00045)
Name Homeobox protein Rhox5 (PEM)
Synonyms   Click to Show/Hide Synonyms of This Protein
Homeobox protein Pem; Placenta and embryonic expression protein; Reproductive homeobox on chromosome X 5; Rhox5; Pem
Gene Name Rhox5 Gene ID
.
UniProt ID
P52651
Family Transcription factor (TF)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MEAEGSSRKVTRLLRLGVKEDSEEQHDVKAEAFFQAGEGRDEQGAQGQPGVGAVGTEGEG
EELNGGKGHFGPGAPGPMGDGDKDSGTRAGGVEQEQNEPVAEGTESQENGNPGGRQMPLQ
GSRFAQHRLRELESILQRTNSFDVPREDLDRLMDACVSRVQNWFKIRRAAARRTRRRATP
VPEHFRGTFECPACRGVRWGERCPFATPRF
Function Transcription factor required for differentiation of embryonic stem cells (ESCs) into primordial germ cells.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change RHOX5 protein abundance levels: increase (FC = 2.13)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the increase of RHOX5 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.