Details of Protein

General Information of Protein (ID: PRT00037)
Name U1 small nuclear ribonucleoprotein A (SNRPA)
Synonyms   Click to Show/Hide Synonyms of This Protein
U1 snRNP A; U1-A; U1A; SNRPA
Gene Name SNRPA Gene ID
6626
UniProt ID
P09012
Family RNA recognition motif (Rnrmo)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFK
EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPA
TKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQI
PPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
Structure
1AUD ; 1DRZ ; 1DZ5 ; 1FHT ; 1M5K ; 1M5O ; 1M5P ; 1M5V ; 1NU4 ; 1OIA ; 1SJ3 ; 1SJ4 ; 1SJF ; 1U6B ; 1URN ; 1VBX ; 1VBY ; 1VBZ ; 1VC0 ; 1VC5 ; 1VC6 ; 1ZZN ; 2A3J ; 2NZ4 ; 2OIH ; 2OJ3 ; 2U1A ; 3BO2 ; 3BO3 ; 3BO4 ; 3CUL ; 3CUN ; 3EGZ ; 3G8S ; 3G8T ; 3G96 ; 3G9C ; 3HHN ; 3IIN ; 3IRW ; 3IWN ; 3K0J ; 3L3C ; 3MUM ; 3MUR ; 3MUT ; 3MUV ; 3MXH ; 3P49 ; 3PGW ; 3R1H ; 3R1L ; 3UCU ; 3UCZ ; 3UD3 ; 3UD4 ; 3UTR ; 4C4W ; 4PR6 ; 4PRF ; 4W90 ; 4W92 ; 4YB1 ; 5DDO ; 5DDP ; 5DDQ ; 5DDR ; 5FJ4 ; 6LAS ; 6LAU ; 6LAX ; 6LAZ ; 6QX9 ; 6SQN ; 6SQQ ; 6SQT ; 6SQV ; 6SR7 ; 6XH0 ; 6XH1 ; 6XH2 ; 6XH3 ; 7B0Y ; 7D7V
Function Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1 snRNP is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. SNRPA binds stem loop II of U1 snRNA. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process. May bind preferentially to the 5'-UGCAC-3' motif on RNAs.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change SNRPA protein abundance levels: increase (FC = 1.39)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of SNRPA protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.