| General Information of Protein (ID: PRT00037) |
| Name |
U1 small nuclear ribonucleoprotein A (SNRPA)
|
| Synonyms |
Click to Show/Hide Synonyms of This Protein
U1 snRNP A; U1-A; U1A; SNRPA
|
| Gene Name |
SNRPA
|
Gene ID |
|
| UniProt ID |
|
| Family |
RNA recognition motif (Rnrmo)
|
|
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
|
| Sequence |
MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFK EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPA TKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQI PPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
|
| Structure |
1AUD
; 1DRZ
; 1DZ5
; 1FHT
; 1M5K
; 1M5O
; 1M5P
; 1M5V
; 1NU4
; 1OIA
; 1SJ3
; 1SJ4
; 1SJF
; 1U6B
; 1URN
; 1VBX
; 1VBY
; 1VBZ
; 1VC0
; 1VC5
; 1VC6
; 1ZZN
; 2A3J
; 2NZ4
; 2OIH
; 2OJ3
; 2U1A
; 3BO2
; 3BO3
; 3BO4
; 3CUL
; 3CUN
; 3EGZ
; 3G8S
; 3G8T
; 3G96
; 3G9C
; 3HHN
; 3IIN
; 3IRW
; 3IWN
; 3K0J
; 3L3C
; 3MUM
; 3MUR
; 3MUT
; 3MUV
; 3MXH
; 3P49
; 3PGW
; 3R1H
; 3R1L
; 3UCU
; 3UCZ
; 3UD3
; 3UD4
; 3UTR
; 4C4W
; 4PR6
; 4PRF
; 4W90
; 4W92
; 4YB1
; 5DDO
; 5DDP
; 5DDQ
; 5DDR
; 5FJ4
; 6LAS
; 6LAU
; 6LAX
; 6LAZ
; 6QX9
; 6SQN
; 6SQQ
; 6SQT
; 6SQV
; 6SR7
; 6XH0
; 6XH1
; 6XH2
; 6XH3
; 7B0Y
; 7D7V
|
| Function |
Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1 snRNP is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. SNRPA binds stem loop II of U1 snRNA. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process. May bind preferentially to the 5'-UGCAC-3' motif on RNAs.
|
|
Regulatory Network
|
|
|
|
|
|
|
|
|