Details of Protein

General Information of Protein (ID: PRT00020)
Name Meiosis protein 5 homolog (MEI5)
Synonyms   Click to Show/Hide Synonyms of This Protein
Swi5-dependent recombination DNA repair protein 1 homolog; Meiosis protein 5 homolog; Sfr1; Mei5; Meir5
Gene Name Sfr1 Gene ID
67788
UniProt ID
Q8BP27
Family DNA binding protein (DNBP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAEEGNQEFTSKMENSSDSASTSPDAPQPSENPPSPPTSPAAPQTSENPPSPPTSPAVPQ
TRENPPSPPTSPAAPQPRENPPSPPTSPAAPQPRENPPSPPTSPAAPQPRENPPSPHSNS
SGKQPLSGTPKERLKKARSSSHSFCSVVKRMKVENDENNETLSEPGESSKEENCSKAQES
LKNKDSEPGEKSSEEKNTCESKSSDTGSSNALPKESENAIIREKLKQEKIRLIRQVEEKE
DLLRRLKLVKMYRIKNDVTELENLIKKWRKCGQRLLCELQSIMSEDEDEKLTLTELIDFY
GIDDNLLHYNRSEEEFTGV
Function Component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination. Acts as a transcriptional modulator for ESR1.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change SFR1 protein abundance levels: increase (FC = 1.81)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the increase of SFR1 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.