Details of Protein
General Information of Protein (ID: PRT00009) | |||||
---|---|---|---|---|---|
Name | Dual specificity protein phosphatase 1 (DUSP1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Mitogen-activated protein kinase phosphatase 1; MAP kinase phosphatase 1; MKP-1; Protein-tyrosine phosphatase CL100; Protein-tyrosine phosphatase non-receptor type 16; Dusp1; Cl100; Mkp1; Ptpn16
|
||||
Gene Name | Dusp1 | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
EC Number | EC: 3.1.3.16 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MVMEVGILDAGGLRALLRERAAQCLLLDCRSFFAFNAGHIVGSVNVRFSTIVRRRAKGAM
GLEHIVPNTELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARSTQVFF LQGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILSF LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA IDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHPTNSALNYLQSP ITTSPSC |
||||
Function | Dual specificity phosphatase that dephosphorylates MAP kinase MAPK1/ERK2 on both 'Thr-183' and 'Tyr-185', regulating its activity during the meiotic cell cycle. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine addition (6 hours) | |||||
Induced Change | DUSP1 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Sepsis [ICD-11: 1G40] | |||||
Details | It is reported that glutamine addition causes the increase of DUSP1 protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.